SCOPe 2.08: Domain d5c5ab_: 5c5a B:

Lineage for d5c5ab_ (5c5a B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)

8. Domain d5c5ab_: 5c5a B: [318939]
   automated match to d4ereb_
   complexed with cl, iod, nut, so4

Details for d5c5ab_

PDB Entry: 5c5a, 1.15 Å

PDB Description: crystal structure of hdm2 in complex with nutlin-3a

PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d5c5ab_:

Sequence; same for both SEQRES and ATOM records:

>d5c5ab_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
paseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsn
dllgdlfgvpsfsvkehrkiytmiyrnlvvvn

Timeline for d5c5ab_:

• d5c5ab_ first appeared in SCOPe 2.06
  
• d5c5ab_ appears in SCOPe 2.07