| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Geobacillus stearothermophilus [TaxId:1422] [225639] (6 PDB entries) |
| Domain d5c3mb1: 5c3m B:5-172 [318931] Other proteins in same PDB: d5c3ma2, d5c3mb2, d5c3mc2, d5c3md2 automated match to d1s6ya1 complexed with mn |
PDB Entry: 5c3m (more details), 3.06 Å
SCOPe Domain Sequences for d5c3mb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c3mb1 c.2.1.0 (B:5-172) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
lkmatigggssytpelveglikryhelpvgelwlvdipegkekleivgalakrmvekagv
pieihltldrrralegadfvttqfrvgglearakderiplkygvigqetngpgglfkglr
tipvildiirdmeelcpdawlinftnpagmvteavlrytkqekvvglc
Timeline for d5c3mb1: