SCOPe 2.06: Domain d5b4la_: 5b4l A:

Lineage for d5b4la_ (5b4l A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)

8. Domain d5b4la_: 5b4l A: [318930]
   automated match to d4hf4a_
   complexed with 6dw, mg, zn

Details for d5b4la_

PDB Entry: 5b4l, 2.4 Å

PDB Description: crystal structure of the catalytic domain of human pde10a complexed with 1-(cyclopropylmethyl)-5-(2-(2,3-dihydro-1h-imidazo[1,2- a]benzimidazol-1-yl)ethoxy)-3-(1-phenyl-1h-pyrazol-5-yl)pyridazin- 4(1h)-one

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5b4la_:

Sequence; same for both SEQRES and ATOM records:

>d5b4la_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfims
vkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsy
lqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatd
lalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiya
efwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllka
crdnlsqwekvirge

Timeline for d5b4la_:

• d5b4la_ is new in SCOPe 2.06-stable
  
• d5b4la_ appears in SCOPe 2.07
  
• d5b4la_ appears in the current release, SCOPe 2.08