![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (18 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Adenylate kinase [52554] (14 species) |
![]() | Species Cow (Bos taurus), mitochondrial izozyme-3 [TaxId:9913] [52557] (1 PDB entry) contains a rudiment "zinc-finger" subdomain, residue 125-161 |
![]() | Domain d2ak3b1: 2ak3 B:0-124,B:162-220 [31893] Other proteins in same PDB: d2ak3a2, d2ak3b2 complexed with amp, so4 |
PDB Entry: 2ak3 (more details), 1.85 Å
SCOP Domain Sequences for d2ak3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ak3b1 c.37.1.1 (B:0-124,B:162-220) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3} gasarllraaimgapgsgkgtvssritkhfelkhlssgdllrdnmlrgteigvlaktfid qgklipddvmtrlvlhelknltqynwlldgfprtlpqaealdrayqidtvinlnvpfevi kqrltXdrpetvvkrlkayeaqtepvleyyrkkgvletfsgtetnkiwphvyaflqtklp qrsqe
Timeline for d2ak3b1: