SCOP 1.67: Domain d2ak3b1: 2ak3 B:0-124,B:162-220

Lineage for d2ak3b1 (2ak3 B:0-124,B:162-220)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Adenylate kinase [52554] (13 species)

7. Species Cow (Bos taurus), mitochondrial izozyme-3 [TaxId:9913] [52557] (1 PDB entry)
   contains a rudiment "zinc-finger" subdomain, residue 125-161

8. Domain d2ak3b1: 2ak3 B:0-124,B:162-220 [31893]
   Other proteins in same PDB: d2ak3a2, d2ak3b2
   complexed with amp, so4

Details for d2ak3b1

PDB Entry: 2ak3, 1.85 Å

PDB Description: the three-dimensional structure of the complex between mitochondrial matrix adenylate kinase and its substrate amp at 1.85 angstroms resolution

SCOP Domain Sequences for d2ak3b1:

Sequence; same for both SEQRES and ATOM records:

>d2ak3b1 c.37.1.1 (B:0-124,B:162-220) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3}
gasarllraaimgapgsgkgtvssritkhfelkhlssgdllrdnmlrgteigvlaktfid
qgklipddvmtrlvlhelknltqynwlldgfprtlpqaealdrayqidtvinlnvpfevi
kqrltXdrpetvvkrlkayeaqtepvleyyrkkgvletfsgtetnkiwphvyaflqtklp
qrsqe

Timeline for d2ak3b1:

• d2ak3b1 first appeared (with stable ids) in SCOP 1.55
  
• d2ak3b1 appears in SCOP 1.65
  
• d2ak3b1 appears in SCOP 1.69
  
• d2ak3b1 appears in the current release, SCOPe 2.08