SCOPe 2.06: Domain d5c94a1: 5c94 A:1-111

Lineage for d5c94a1 (5c94 A:1-111)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.140: Replicase NSP9 [101815] (1 superfamily)
   barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel

4. Superfamily b.140.1: Replicase NSP9 [101816] (2 families)

5. Family b.140.1.0: automated matches [191526] (1 protein)
   not a true family

6. Protein automated matches [190886] (3 species)
   not a true protein

7. Species Avian infectious bronchitis virus [TaxId:11127] [318923] (1 PDB entry)

8. Domain d5c94a1: 5c94 A:1-111 [318924]
   Other proteins in same PDB: d5c94a2
   automated match to d1qz8a_
   complexed with gol, peg

Details for d5c94a1

PDB Entry: 5c94, 2.44 Å

PDB Description: infectious bronchitis virus nsp9

PDB Compounds: (A:) Non-structural protein 9

SCOPe Domain Sequences for d5c94a1:

Sequence; same for both SEQRES and ATOM records:

>d5c94a1 b.140.1.0 (A:1-111) automated matches {Avian infectious bronchitis virus [TaxId: 11127]}
nnelmphgvktkacvagvdqahcsveskcyytsisgssvvaaitssnpnlkvasflneag
nqiyvdldppckfgmkvgdkvevvylyfikntrsivrgmvlgaisnvvvlq

Timeline for d5c94a1:

• d5c94a1 is new in SCOPe 2.06-stable
  
• d5c94a1 appears in SCOPe 2.07
  
• d5c94a1 appears in the current release, SCOPe 2.08