Lineage for d5caeb1 (5cae B:1-245)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541608Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 2541609Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species)
  7. 2541635Species Pig (Sus scrofa) [TaxId:9823] [56084] (8 PDB entries)
    GTP-specific enzyme
  8. 2541640Domain d5caeb1: 5cae B:1-245 [318910]
    Other proteins in same PDB: d5caea1, d5caea2, d5caeb2
    automated match to d2nu8b2
    complexed with cl, coa, gol, mg, po4, sin

Details for d5caeb1

PDB Entry: 5cae (more details), 2.2 Å

PDB Description: succinate bound to pig gtp-specific succinyl-coa synthetase
PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial

SCOPe Domain Sequences for d5caeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5caeb1 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
dksen

SCOPe Domain Coordinates for d5caeb1:

Click to download the PDB-style file with coordinates for d5caeb1.
(The format of our PDB-style files is described here.)

Timeline for d5caeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5caeb2