Lineage for d5chta1 (5cht A:46-367)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2498051Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2498052Protein automated matches [190230] (21 species)
    not a true protein
  7. 2498157Species Mouse (Mus musculus) [TaxId:10090] [318905] (2 PDB entries)
  8. 2498158Domain d5chta1: 5cht A:46-367 [318906]
    Other proteins in same PDB: d5chta2
    automated match to d2ibia1
    complexed with zn

Details for d5chta1

PDB Entry: 5cht (more details), 2.8 Å

PDB Description: crystal structure of usp18
PDB Compounds: (A:) Ubl carboxyl-terminal hydrolase 18

SCOPe Domain Sequences for d5chta1:

Sequence, based on SEQRES records: (download)

>d5chta1 d.3.1.0 (A:46-367) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dsphglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqllllle
kmqdsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglf
tiwtqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmc
cescgektpwkqvlklthlpqtltihlmrfsarnsrtekichsvnfpqsldfsqvlptee
dlgdtkeqseihyelfaviahvgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqc
tygnhryrwretayllvytktg

Sequence, based on observed residues (ATOM records): (download)

>d5chta1 d.3.1.0 (A:46-367) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dsphglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqllllle
kmqdsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglf
tiwtqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmc
cescgektpwkqvlklthlpqtltihlmrfsartekichsvnfpqsldfsqveihyelfa
viahvgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqctygnhryrwretayllv
ytktg

SCOPe Domain Coordinates for d5chta1:

Click to download the PDB-style file with coordinates for d5chta1.
(The format of our PDB-style files is described here.)

Timeline for d5chta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5chta2
View in 3D
Domains from other chains:
(mouse over for more information)
d5chtb_