Lineage for d5c71d3 (5c71 D:276-592)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (93 species)
    not a true protein
  7. 2419107Species Fungus (Aspergillus oryzae) [TaxId:5062] [256307] (3 PDB entries)
  8. 2419112Domain d5c71d3: 5c71 D:276-592 [318902]
    Other proteins in same PDB: d5c71a1, d5c71a2, d5c71b1, d5c71b2, d5c71c1, d5c71c2, d5c71d1, d5c71d2
    automated match to d5czkb3
    complexed with cbw, gcu

Details for d5c71d3

PDB Entry: 5c71 (more details), 2.62 Å

PDB Description: the structure of aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide
PDB Compounds: (D:) Glucuronidase

SCOPe Domain Sequences for d5c71d3:

Sequence, based on SEQRES records: (download)

>d5c71d3 c.1.8.0 (D:276-592) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
vkvqgtqflindkpfyftgfgkhedtnirgkghddaymvhdfqllhwmgansfrtshypy
aeevmeyadrqgivvidetpavglafsigagaqtsnppatfspdrinnktreahaqaire
lihrdknhpsvvmwsiandpasnedgareyfaplpklarqldptrpvtfanvglatykad
riadlfdvlclnryfgwytqtaeldeaeaaleeelrgwtekydkpivmtdygadtvaglh
svmvtpwseefqvemldmyhrvfdrfeamageqvwnfadfqtavgvsrvdgnkkgvftrd
rkpkaaahllrkrwtnl

Sequence, based on observed residues (ATOM records): (download)

>d5c71d3 c.1.8.0 (D:276-592) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
vkvqgtqflindkpfyftgfgkhedtnirgkghddaymvhdfqllhwmgansfrtshypy
aeevmeyadrqgivvidetpavglafspatfspdrinnktreahaqairelihrdknhps
vvmwsiandpasnedgareyfaplpklarqldptrpvtfanvglatykadriadlfdvlc
lnryfgwytqtaeldeaeaaleeelrgwtekydkpivmtdygadtvaglhsvmvtpwsee
fqvemldmyhrvfdrfeamageqvwnfadfqtavgvsrvdgnkkgvftrdrkpkaaahll
rkrwtnl

SCOPe Domain Coordinates for d5c71d3:

Click to download the PDB-style file with coordinates for d5c71d3.
(The format of our PDB-style files is described here.)

Timeline for d5c71d3: