Lineage for d5c71d1 (5c71 D:1-180)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775223Species Fungus (Aspergillus oryzae) [TaxId:5062] [256310] (3 PDB entries)
  8. 2775227Domain d5c71d1: 5c71 D:1-180 [318900]
    Other proteins in same PDB: d5c71a2, d5c71a3, d5c71b2, d5c71b3, d5c71c2, d5c71c3, d5c71d2, d5c71d3
    automated match to d5czkb1
    complexed with cbw, gcu

Details for d5c71d1

PDB Entry: 5c71 (more details), 2.62 Å

PDB Description: the structure of aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide
PDB Compounds: (D:) Glucuronidase

SCOPe Domain Sequences for d5c71d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c71d1 b.18.1.0 (D:1-180) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
mlkpqqtttrdlisldglwkfalasddnntqpwtsqlktslecpvpasyndifadskihd
hvgwvyyqrdvivpkgwseerylvrceaathhgriyvngnlvadhvggytpfeaditdlv
aageqfrltiavdneltyqtippgkveileatgkkvqtyqhdfynyaglarsvwlysvpq

SCOPe Domain Coordinates for d5c71d1:

Click to download the PDB-style file with coordinates for d5c71d1.
(The format of our PDB-style files is described here.)

Timeline for d5c71d1: