Lineage for d1nkse_ (1nks E:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1162957Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1162962Protein Adenylate kinase [52554] (15 species)
  7. 1163014Species Sulfolobus acidocaldarius [TaxId:2285] [52556] (1 PDB entry)
  8. 1163019Domain d1nkse_: 1nks E: [31890]
    complexed with adp, amp

Details for d1nkse_

PDB Entry: 1nks (more details), 2.57 Å

PDB Description: adenylate kinase from sulfolobus acidocaldarius
PDB Compounds: (E:) adenylate kinase

SCOPe Domain Sequences for d1nkse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkse_ c.37.1.1 (E:) Adenylate kinase {Sulfolobus acidocaldarius [TaxId: 2285]}
mkigivtgipgvgkstvlakvkeildnqginnkiinygdfmlatalklgyakdrdemrkl
svekqkklqidaakgiaeearaggegylfidthavirtpsgylpglpsyviteinpsvif
lleadpkiilsrqkrdttrnrndysdesviletinfaryaatasavlagstvkvivnveg
dpsiaaneiirsmk

SCOPe Domain Coordinates for d1nkse_:

Click to download the PDB-style file with coordinates for d1nkse_.
(The format of our PDB-style files is described here.)

Timeline for d1nkse_: