Lineage for d1nkse_ (1nks E:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins) 
Protein Adenylate kinase [52554] (8 species) 
Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [52556] (1 PDB entry) 
Domain d1nkse_: 1nks E: [31890]
Details for d1nkse_
PDB Entry: 1nks (more details), 2.57 Å
PDB Description: adenylate kinase from sulfolobus acidocaldarius
SCOP Domain Sequences for d1nkse_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nkse_ c.37.1.1 (E:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius}
mkigivtgipgvgkstvlakvkeildnqginnkiinygdfmlatalklgyakdrdemrkl
svekqkklqidaakgiaeearaggegylfidthavirtpsgylpglpsyviteinpsvif
lleadpkiilsrqkrdttrnrndysdesviletinfaryaatasavlagstvkvivnveg
dpsiaaneiirsmk
SCOP Domain Coordinates for d1nkse_:
Click to download the PDB-style file with coordinates for d1nkse_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nkse_:
- d1nkse_ first appeared (with stable ids) in SCOP 1.55
- d1nkse_ appears in SCOP 1.57
- d1nkse_ appears in SCOP 1.61
- d1nkse_ appears in the current release, SCOPe 2.08
View in 3D
