Lineage for d5aqdg_ (5aqd G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979193Protein automated matches [190531] (18 species)
    not a true protein
  7. 1979280Species Phormidium rubidum [TaxId:865859] [272704] (5 PDB entries)
  8. 1979359Domain d5aqdg_: 5aqd G: [318890]
    automated match to d1eyxa_
    complexed with gol, peb, so4

Details for d5aqdg_

PDB Entry: 5aqd (more details), 2.12 Å

PDB Description: crystal structure of phormidium phycoerythrin at ph 8.5
PDB Compounds: (G:) Phycoerythrin alpha subunit

SCOPe Domain Sequences for d5aqdg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aqdg_ a.1.1.3 (G:) automated matches {Phormidium rubidum [TaxId: 865859]}
mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
glptapyvealsfarnrgcaprdmsaqalteynalldyainsls

SCOPe Domain Coordinates for d5aqdg_:

Click to download the PDB-style file with coordinates for d5aqdg_.
(The format of our PDB-style files is described here.)

Timeline for d5aqdg_: