Lineage for d1nksd_ (1nks D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123299Protein Adenylate kinase [52554] (16 species)
  7. 2123358Species Sulfolobus acidocaldarius [TaxId:2285] [52556] (1 PDB entry)
  8. 2123362Domain d1nksd_: 1nks D: [31889]
    complexed with adp, amp

Details for d1nksd_

PDB Entry: 1nks (more details), 2.57 Å

PDB Description: adenylate kinase from sulfolobus acidocaldarius
PDB Compounds: (D:) adenylate kinase

SCOPe Domain Sequences for d1nksd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nksd_ c.37.1.1 (D:) Adenylate kinase {Sulfolobus acidocaldarius [TaxId: 2285]}
mkigivtgipgvgkstvlakvkeildnqginnkiinygdfmlatalklgyakdrdemrkl
svekqkklqidaakgiaeearaggegylfidthavirtpsgylpglpsyviteinpsvif
lleadpkiilsrqkrdttrnrndysdesviletinfaryaatasavlagstvkvivnveg
dpsiaaneiirsmk

SCOPe Domain Coordinates for d1nksd_:

Click to download the PDB-style file with coordinates for d1nksd_.
(The format of our PDB-style files is described here.)

Timeline for d1nksd_: