Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (60 species) not a true protein |
Species Corallococcus coralloides [TaxId:184914] [312199] (3 PDB entries) |
Domain d5c1ja1: 5c1j A:6-185 [318888] automated match to d4yuca1 complexed with mpd |
PDB Entry: 5c1j (more details), 1.7 Å
SCOPe Domain Sequences for d5c1ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c1ja1 c.95.1.0 (A:6-185) automated matches {Corallococcus coralloides [TaxId: 184914]} vfplpfkiaglgryvpadvvlssdlekkydlppgwcvekqgirerrwvkdetasfmgaea akeavrdaglkledidliinasgspeqavpdggplvqrelglgrsgvpsitvnasclsff valdvaanylnmrrykrilivssdissvaldfrkpenftlfgdaaaaavvtlpepgeksc
Timeline for d5c1ja1: