![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (18 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Adenylate kinase [52554] (14 species) |
![]() | Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [52556] (1 PDB entry) |
![]() | Domain d1nksc_: 1nks C: [31888] |
PDB Entry: 1nks (more details), 2.57 Å
SCOP Domain Sequences for d1nksc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nksc_ c.37.1.1 (C:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius} mkigivtgipgvgkstvlakvkeildnqginnkiinygdfmlatalklgyakdrdemrkl svekqkklqidaakgiaeearaggegylfidthavirtpsgylpglpsyviteinpsvif lleadpkiilsrqkrdttrnrndysdesviletinfaryaatasavlagstvkvivnveg dpsiaaneiirsmk
Timeline for d1nksc_: