Lineage for d1nksa_ (1nks A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121669Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins)
  6. 121670Protein Adenylate kinase [52554] (8 species)
  7. 121671Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [52556] (1 PDB entry)
  8. 121672Domain d1nksa_: 1nks A: [31886]

Details for d1nksa_

PDB Entry: 1nks (more details), 2.57 Å

PDB Description: adenylate kinase from sulfolobus acidocaldarius

SCOP Domain Sequences for d1nksa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius}
mkigivtgipgvgkstvlakvkeildnqginnkiinygdfmlatalklgyakdrdemrkl
svekqkklqidaakgiaeearaggegylfidthavirtpsgylpglpsyviteinpsvif
lleadpkiilsrqkrdttrnrndysdesviletinfaryaatasavlagstvkvivnveg
dpsiaaneiirsmk

SCOP Domain Coordinates for d1nksa_:

Click to download the PDB-style file with coordinates for d1nksa_.
(The format of our PDB-style files is described here.)

Timeline for d1nksa_: