![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
![]() | Protein automated matches [190246] (57 species) not a true protein |
![]() | Species Myxococcus xanthus [TaxId:246197] [318813] (2 PDB entries) |
![]() | Domain d5jbxb1: 5jbx B:1-258 [318849] Other proteins in same PDB: d5jbxb2, d5jbxc2 automated match to d4f47a_ complexed with coa, mli |
PDB Entry: 5jbx (more details), 1.1 Å
SCOPe Domain Sequences for d5jbxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jbxb1 c.14.1.0 (B:1-258) automated matches {Myxococcus xanthus [TaxId: 246197]} mpefkvdargpieiwtidgesrrnaisramlkelgelvtrvsssrdvravvitgagdkaf cagadlkeratmaedevrafldglrrtfraieksdcvfiaaingaalgggtelalacdlr vaapaaelgltevklgiipggggtqrlarlvgpgrakdliltarrinaaeafsvglanrl apeghllavayglaesvvenapiavatakhaidegtglelddalalelrkyeeilktedr leglrafaekrapvykgr
Timeline for d5jbxb1: