![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
![]() | Protein automated matches [190492] (24 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:160488] [256090] (4 PDB entries) |
![]() | Domain d5j3wb_: 5j3w B: [318846] automated match to d1ew0a_ complexed with fmn |
PDB Entry: 5j3w (more details), 2.55 Å
SCOPe Domain Sequences for d5j3wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j3wb_ d.110.3.0 (B:) automated matches {Pseudomonas putida [TaxId: 160488]} minaqllqsmvdasndgivvaekegddtiliyvnaafeyltgysrdeilyqdcrflqgdd rdqlgrarirkamaegrpcrevlrnyrkdgsafwnelsitpvksdfdqrtyfigiqkdvs rqvelerelaelra
Timeline for d5j3wb_: