Lineage for d5j3wb_ (5j3w B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970785Species Pseudomonas putida [TaxId:160488] [256090] (4 PDB entries)
  8. 2970794Domain d5j3wb_: 5j3w B: [318846]
    automated match to d1ew0a_
    complexed with fmn

Details for d5j3wb_

PDB Entry: 5j3w (more details), 2.55 Å

PDB Description: crystal structures reveal signaling states of a short blue light photoreceptor protein ppsb1-lov (dark state)
PDB Compounds: (B:) Sensory box protein

SCOPe Domain Sequences for d5j3wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j3wb_ d.110.3.0 (B:) automated matches {Pseudomonas putida [TaxId: 160488]}
minaqllqsmvdasndgivvaekegddtiliyvnaafeyltgysrdeilyqdcrflqgdd
rdqlgrarirkamaegrpcrevlrnyrkdgsafwnelsitpvksdfdqrtyfigiqkdvs
rqvelerelaelra

SCOPe Domain Coordinates for d5j3wb_:

Click to download the PDB-style file with coordinates for d5j3wb_.
(The format of our PDB-style files is described here.)

Timeline for d5j3wb_: