SCOPe 2.08: Domain d4zxpa1: 4zxp A:3-197

Lineage for d4zxpa1 (4zxp A:3-197)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (11 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [311867] (9 PDB entries)

8. Domain d4zxpa1: 4zxp A:3-197 [318844]
   Other proteins in same PDB: d4zxpa2, d4zxpb2
   automated match to d4y2zb_
   complexed with flc

Details for d4zxpa1

PDB Entry: 4zxp, 1.63 Å

PDB Description: crystal structure of peptidyl- trna hydrolase from vibrio cholerae

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4zxpa1:

Sequence; same for both SEQRES and ATOM records:

>d4zxpa1 c.56.3.0 (A:3-197) automated matches {Vibrio cholerae [TaxId: 243277]}
sqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsqel
rvlipttfmnlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghnglkd
tisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqecldaavdesvrcleilmkd
gltkaqnrlhtfkae

Timeline for d4zxpa1:

• d4zxpa1 first appeared in SCOPe 2.06
  
• d4zxpa1 appears in SCOPe 2.07