Lineage for d5jhza2 (5jhz A:476-784)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720778Species Magnaporthe oryzae [TaxId:242507] [226424] (5 PDB entries)
  8. 2720796Domain d5jhza2: 5jhz A:476-784 [318842]
    automated match to d3ut2a2
    complexed with hem

Details for d5jhza2

PDB Entry: 5jhz (more details), 1.7 Å

PDB Description: crystal structure of fungal magkatg2 at ph 7.0
PDB Compounds: (A:) Catalase-peroxidase 2

SCOPe Domain Sequences for d5jhza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhza2 a.93.1.0 (A:476-784) automated matches {Magnaporthe oryzae [TaxId: 242507]}
kesfiwqdplparegdliddadvdklkaailstdgldvsklastamacattyrnsdkrgg
cngarialepqrnwvsnnptqlsavldalkkvqsdfngsngnkkvsladlivlggtaave
kaakdagvdikvpfsagrvdatqeqtdvtqfsylepqadgfrnygrgtararteeimvdk
asqltltppeltvlvggmralganydgsdvgvftankgkltpdffvnlvdmniawtasga
dgeswvgtdrksrsekykgsradlvfgshaelraiaevyaengnqekfvkdfvaawtkvm
nldrfdlkv

SCOPe Domain Coordinates for d5jhza2:

Click to download the PDB-style file with coordinates for d5jhza2.
(The format of our PDB-style files is described here.)

Timeline for d5jhza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jhza1