Lineage for d3vtka_ (3vtk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109585Protein Thymidine kinase [52552] (4 species)
    contains insert all-alpha subdomain, res. 251-322
  7. 2109599Species Herpes simplex virus type 1, different strains [TaxId:10298] [52553] (33 PDB entries)
    Uniprot P03176 46-375
  8. 2109662Domain d3vtka_: 3vtk A: [31884]
    complexed with 5iu, adp

Details for d3vtka_

PDB Entry: 3vtk (more details), 3 Å

PDB Description: thymidine kinase from herpes simplex virus type 1 in complex with adp and 5-iodo-deoxyuridine-monophosphate
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d3vtka_:

Sequence, based on SEQRES records: (download)

>d3vtka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
gmvqthvttpgsipticdlartfaremgean

Sequence, based on observed residues (ATOM records): (download)

>d3vtka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagspppaltlifdrhpiaa
llcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerld
lamlaairrvygllantvrylqcggswredwgqlsgprphigdtlftlfrapellapngd
lynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticd
lartfaremgean

SCOPe Domain Coordinates for d3vtka_:

Click to download the PDB-style file with coordinates for d3vtka_.
(The format of our PDB-style files is described here.)

Timeline for d3vtka_: