SCOPe 2.08: Domain d5jbxc1: 5jbx C:1-258

Lineage for d5jbxc1 (5jbx C:1-258)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Myxococcus xanthus [TaxId:246197] [318813] (2 PDB entries)

8. Domain d5jbxc1: 5jbx C:1-258 [318826]
   Other proteins in same PDB: d5jbxb2, d5jbxc2
   automated match to d4f47a_
   complexed with coa, mli

Details for d5jbxc1

PDB Entry: 5jbx, 1.1 Å

PDB Description: crystal structure of liuc in complex with coenzyme a and malonic acid

PDB Compounds: (C:) 3-hydroxybutyryl-CoA dehydratase

SCOPe Domain Sequences for d5jbxc1:

Sequence; same for both SEQRES and ATOM records:

>d5jbxc1 c.14.1.0 (C:1-258) automated matches {Myxococcus xanthus [TaxId: 246197]}
mpefkvdargpieiwtidgesrrnaisramlkelgelvtrvsssrdvravvitgagdkaf
cagadlkeratmaedevrafldglrrtfraieksdcvfiaaingaalgggtelalacdlr
vaapaaelgltevklgiipggggtqrlarlvgpgrakdliltarrinaaeafsvglanrl
apeghllavayglaesvvenapiavatakhaidegtglelddalalelrkyeeilktedr
leglrafaekrapvykgr

Timeline for d5jbxc1:

• d5jbxc1 first appeared in SCOPe 2.06
  
• d5jbxc1 appears in SCOPe 2.07