SCOPe 2.08: Domain d5l8za1: 5l8z A:1-93

Lineage for d5l8za1 (5l8z A:1-93)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.0: automated matches [191573] (1 protein)
   not a true family

6. Protein automated matches [191007] (11 species)
   not a true protein

7. Species Spiroplasma melliferum [TaxId:570509] [260909] (3 PDB entries)

8. Domain d5l8za1: 5l8z A:1-93 [318823]
   Other proteins in same PDB: d5l8za2
   automated match to d1owfa_
   complexed with na

Details for d5l8za1

PDB Entry: 5l8z, 1.4 Å

PDB Description: structure of thermostable dna-binding hu protein from micoplasma spiroplasma melliferum

PDB Compounds: (A:) DNA-binding protein

SCOPe Domain Sequences for d5l8za1:

Sequence; same for both SEQRES and ATOM records:

>d5l8za1 a.55.1.0 (A:1-93) automated matches {Spiroplasma melliferum [TaxId: 570509]}
mskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavteraar
dgrnpstgetikipasksakfkagkqlktdlnn

Timeline for d5l8za1:

• d5l8za1 first appeared in SCOPe 2.06
  
• d5l8za1 appears in SCOPe 2.07