Lineage for d5l8za1 (5l8z A:1-93)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323932Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2323933Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2323998Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2323999Protein automated matches [191007] (9 species)
    not a true protein
  7. 2324021Species Spiroplasma melliferum [TaxId:570509] [260909] (3 PDB entries)
  8. 2324023Domain d5l8za1: 5l8z A:1-93 [318823]
    Other proteins in same PDB: d5l8za2
    automated match to d1owfa_
    complexed with na

Details for d5l8za1

PDB Entry: 5l8z (more details), 1.4 Å

PDB Description: structure of thermostable dna-binding hu protein from micoplasma spiroplasma melliferum
PDB Compounds: (A:) DNA-binding protein

SCOPe Domain Sequences for d5l8za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l8za1 a.55.1.0 (A:1-93) automated matches {Spiroplasma melliferum [TaxId: 570509]}
mskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavteraar
dgrnpstgetikipasksakfkagkqlktdlnn

SCOPe Domain Coordinates for d5l8za1:

Click to download the PDB-style file with coordinates for d5l8za1.
(The format of our PDB-style files is described here.)

Timeline for d5l8za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5l8za2