Lineage for d5jbwa1 (5jbw A:1-258)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854116Species Myxococcus xanthus [TaxId:246197] [318813] (2 PDB entries)
  8. 2854120Domain d5jbwa1: 5jbw A:1-258 [318814]
    Other proteins in same PDB: d5jbwa2
    automated match to d4f47a_

Details for d5jbwa1

PDB Entry: 5jbw (more details), 2.05 Å

PDB Description: crystal structure of liuc
PDB Compounds: (A:) 3-hydroxybutyryl-CoA dehydratase

SCOPe Domain Sequences for d5jbwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jbwa1 c.14.1.0 (A:1-258) automated matches {Myxococcus xanthus [TaxId: 246197]}
mpefkvdargpieiwtidgesrrnaisramlkelgelvtrvsssrdvravvitgagdkaf
cagadlkeratmaedevrafldglrrtfraieksdcvfiaaingaalgggtelalacdlr
vaapaaelgltevklgiipggggtqrlarlvgpgrakdliltarrinaaeafsvglanrl
apeghllavayglaesvvenapiavatakhaidegtglelddalalelrkyeeilktedr
leglrafaekrapvykgr

SCOPe Domain Coordinates for d5jbwa1:

Click to download the PDB-style file with coordinates for d5jbwa1.
(The format of our PDB-style files is described here.)

Timeline for d5jbwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jbwa2