Lineage for d5j4ec_ (5j4e C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970797Species Pseudomonas putida [TaxId:303] [318790] (1 PDB entry)
  8. 2970800Domain d5j4ec_: 5j4e C: [318791]
    automated match to d1ew0a_
    complexed with fmn

Details for d5j4ec_

PDB Entry: 5j4e (more details), 2.67 Å

PDB Description: crystal structures reveal signaling states of a short blue light photoreceptor protein ppsb1-lov (photoexcited state)
PDB Compounds: (C:) Sensory box protein

SCOPe Domain Sequences for d5j4ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j4ec_ d.110.3.0 (C:) automated matches {Pseudomonas putida [TaxId: 303]}
minaqllqsmvdasndgivvaekegddtiliyvnaafeyltgysrdeilyqdcrflqgdd
rdqlgrarirkamaegrpcrevlrnyrkdgsafwnelsitpvksdfdqrtyfigiqkdvs
rqvelerelaelra

SCOPe Domain Coordinates for d5j4ec_:

Click to download the PDB-style file with coordinates for d5j4ec_.
(The format of our PDB-style files is described here.)

Timeline for d5j4ec_: