SCOPe 2.06: Domain d5hvgd_: 5hvg D:

Lineage for d5hvgd_ (5hvg D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (35 PDB entries)

8. Domain d5hvgd_: 5hvg D: [318786]
   Other proteins in same PDB: d5hvgb2
   automated match to d4ldeb_
   complexed with act, bma, man, nag, zn

Details for d5hvgd_

PDB Entry: 5hvg, 3.05 Å

PDB Description: crystal structure of thrombin-activatable fibrinolysis inhibitor in complex with an inhibitory nanobody (vhh-a204)

PDB Compounds: (D:) VHH-a204

SCOPe Domain Sequences for d5hvgd_:

Sequence; same for both SEQRES and ATOM records:

>d5hvgd_ b.1.1.1 (D:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlqesggglvqpggslrlscaasgsifsgnamgwyrqapgkqrelvaaitsggstdyad
svkgrftisrdnakntvylqmnslkpedtavyychvdprpwgydvtdydywgqgtqvtv

Timeline for d5hvgd_:

• d5hvgd_ is new in SCOPe 2.06-stable
  
• d5hvgd_ is called d5hvgd1 in SCOPe 2.07
  
• d5hvgd_ appears in the current release, SCOPe 2.08, called d5hvgd1