![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
![]() | Protein automated matches [190615] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187641] (939 PDB entries) |
![]() | Domain d5ig6a1: 5ig6 A:348-454 [318775] Other proteins in same PDB: d5ig6a2, d5ig6a3 automated match to d4uyga_ complexed with 6b3, cl, gol |
PDB Entry: 5ig6 (more details), 0.91 Å
SCOPe Domain Sequences for d5ig6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ig6a1 a.29.2.0 (A:348-454) automated matches {Human (Homo sapiens) [TaxId: 9606]} eqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmenrd yrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp
Timeline for d5ig6a1: