Lineage for d5ihsa_ (5ihs A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2418986Species Cytophaga hutchinsonii [TaxId:269798] [318773] (1 PDB entry)
  8. 2418987Domain d5ihsa_: 5ihs A: [318774]
    automated match to d1lf1a_

Details for d5ihsa_

PDB Entry: 5ihs (more details), 1.1 Å

PDB Description: structure of chu_2103 from cytophaga hutchinsonii
PDB Compounds: (A:) Endoglucanase, glycoside hydrolase family 5 protein

SCOPe Domain Sequences for d5ihsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ihsa_ c.1.8.0 (A:) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
ktivekygklsvkgnymvgqygdtvqlrgmslfwsqwmgqyynsdvvkwlrddwkctvvr
aamgvemdgylenpdtekmkvmevvnaaiakgiyviidyhsheaqknpaaaqrffsemak
kygnipniiyevyneplqatswnkdikpyaegvitkirvydttniivvgtrqwsqlvtea
aanpitrqnimytlhfypgthkqelrneaqkaldmgialfvteygtcdasgngnfspeet
alwyefldahkisycnwsiadkpetasaivpaaspyggwadydltpsgklvrddlrlkng
pifdsl

SCOPe Domain Coordinates for d5ihsa_:

Click to download the PDB-style file with coordinates for d5ihsa_.
(The format of our PDB-style files is described here.)

Timeline for d5ihsa_: