SCOPe 2.06: Domain d5g4ob_: 5g4o B:

Lineage for d5g4ob_ (5g4o B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)

8. Domain d5g4ob_: 5g4o B: [318769]
   automated match to d2feja_
   protein/DNA complex; complexed with o80, zn; mutant

Details for d5g4ob_

PDB Entry: 5g4o, 1.48 Å

PDB Description: crystal structure of the p53 cancer mutant y220c in complex with a trifluorinated derivative of the small molecule stabilizer phikan083

PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d5g4ob_:

Sequence; same for both SEQRES and ATOM records:

>d5g4ob_ b.2.5.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
vcacpgrdrrteeenlr

Timeline for d5g4ob_:

• d5g4ob_ is new in SCOPe 2.06-stable
  
• d5g4ob_ appears in SCOPe 2.07
  
• d5g4ob_ appears in the current release, SCOPe 2.08