| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries) |
| Domain d5dhvh_: 5dhv H: [318765] Other proteins in same PDB: d5dhva2 automated match to d4v1dd_ complexed with cl |
PDB Entry: 5dhv (more details), 2.3 Å
SCOPe Domain Sequences for d5dhvh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dhvh_ b.1.1.0 (H:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qeqlvesggrlvtpgtaltltckvsgfslsgfwlnwvrqapgkglewvgaiyrgsgsewy
aswakgrftisdtsttvtlkltspttedtatyfcaadttdngyftiwgpgtlvtvss
Timeline for d5dhvh_:
View in 3DDomains from other chains: (mouse over for more information) d5dhva1, d5dhva2, d5dhvb_, d5dhvl_ |