SCOPe 2.08: Domain d5a4bb1: 5a4b B:35-148

Lineage for d5a4bb1 (5a4b B:35-148)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)

8. Domain d5a4bb1: 5a4b B:35-148 [318751]
   automated match to d1wkua1
   mutant

Details for d5a4bb1

PDB Entry: 5a4b, 2.01 Å

PDB Description: mutations in the calponin homology domain of alpha-actinin-2 affect actin binding and incorporation in muscle.

PDB Compounds: (B:) human alpha-actinin-2

SCOPe Domain Sequences for d5a4bb1:

Sequence; same for both SEQRES and ATOM records:

>d5a4bb1 a.40.1.0 (B:35-148) automated matches {Human (Homo sapiens) [TaxId: 9606]}
awekqqrktftawcnshlrkagtqienieedfrnglklmlllevisgerlpkpdrgkmrf
hkianvnkaldyiaskgvklvsigteeivdgnvkmtlgmiwtiilrfaiqdisv

Timeline for d5a4bb1:

• d5a4bb1 first appeared in SCOPe 2.06
  
• d5a4bb1 appears in SCOPe 2.07