Lineage for d5ci2a_ (5ci2 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314100Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 2314398Protein automated matches [190435] (10 species)
    not a true protein
  7. 2314464Species Escherichia coli [TaxId:83334] [318744] (2 PDB entries)
  8. 2314465Domain d5ci2a_: 5ci2 A: [318745]
    automated match to d1jqcb_
    complexed with feo, so4

Details for d5ci2a_

PDB Entry: 5ci2 (more details), 2.25 Å

PDB Description: ribonucleotide reductase y122 2,3,6-f3y variant
PDB Compounds: (A:) ribonucleoside-diphosphate reductase 1 subunit beta

SCOPe Domain Sequences for d5ci2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ci2a_ a.25.1.2 (A:) automated matches {Escherichia coli [TaxId: 83334]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sxthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvsdnvqvapq

SCOPe Domain Coordinates for d5ci2a_:

Click to download the PDB-style file with coordinates for d5ci2a_.
(The format of our PDB-style files is described here.)

Timeline for d5ci2a_: