Lineage for d5f92d_ (5f92 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337388Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2337389Protein automated matches [190621] (25 species)
    not a true protein
  7. 2337470Species Mycobacterium tuberculosis [TaxId:83331] [318734] (2 PDB entries)
  8. 2337474Domain d5f92d_: 5f92 D: [318736]
    automated match to d4apbd_
    complexed with cl, fmt, pg4

Details for d5f92d_

PDB Entry: 5f92 (more details), 1.86 Å

PDB Description: fumarate hydratase of mycobacterium tuberculosis in complex with formate
PDB Compounds: (D:) fumarate hydratase class II

SCOPe Domain Sequences for d5f92d_:

Sequence, based on SEQRES records: (download)

>d5f92d_ a.127.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
anyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkgacaqvnsd
lgllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasiaakggvtl
hpnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwhtvvksgrth
lmdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapddfgvrvva
vlvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmgsgpltgla
eiqlpdlqpgssimpgkvnpvlpeavtqvaaqvigndaaiawggangafelnvyipmmar
nilesfklltnvsrlfaqrciagltanvehlrrlaesspsivtplnsaigyeeaaavakq
alkerktirqtvidrgligdrlsiedldrrldvlamakaeql

Sequence, based on observed residues (ATOM records): (download)

>d5f92d_ a.127.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
anyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkgacaqvnsd
lgllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasiaakggvtl
hpnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwhtvvksgrth
lmdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapddfgvrvva
vlvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmgsgpltgla
eiqlpdlqpkvnpvlpeavtqvaaqvigndaaiawggangafelnvyipmmarnilesfk
lltnvsrlfaqrciagltanvehlrrlaesspsivtplnsaigyeeaaavakqalkerkt
irqtvidrgligdrlsiedldrrldvlamakaeql

SCOPe Domain Coordinates for d5f92d_:

Click to download the PDB-style file with coordinates for d5f92d_.
(The format of our PDB-style files is described here.)

Timeline for d5f92d_: