![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein automated matches [190435] (11 species) not a true protein |
![]() | Species Escherichia coli [TaxId:745156] [318697] (2 PDB entries) |
![]() | Domain d5ci1a_: 5ci1 A: [318728] automated match to d1jqcb_ complexed with cl, feo, so4 |
PDB Entry: 5ci1 (more details), 1.95 Å
SCOPe Domain Sequences for d5ci1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ci1a_ a.25.1.2 (A:) automated matches {Escherichia coli [TaxId: 745156]} ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr sxthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvsdnvqvapq
Timeline for d5ci1a_: