Lineage for d5a38b1 (5a38 B:35-148)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712101Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2712102Protein automated matches [226856] (4 species)
    not a true protein
  7. 2712108Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)
  8. 2712137Domain d5a38b1: 5a38 B:35-148 [318722]
    automated match to d1wkua1
    mutant

Details for d5a38b1

PDB Entry: 5a38 (more details), 1.9 Å

PDB Description: mutations in the calponin homology domain of alpha-actinin-2 affect actin binding and incorporation in muscle.
PDB Compounds: (B:) alpha-actinin-2

SCOPe Domain Sequences for d5a38b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a38b1 a.40.1.0 (B:35-148) automated matches {Human (Homo sapiens) [TaxId: 9606]}
awekqqrktftawcnshlrkagtqienieedfrnglklmlllevisgerlpkpdrgkmrf
hkianvnkaldyiaskgvklvsigaeeivdgnvkmtlgmiwtiilrfaiqdisv

SCOPe Domain Coordinates for d5a38b1:

Click to download the PDB-style file with coordinates for d5a38b1.
(The format of our PDB-style files is described here.)

Timeline for d5a38b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5a38b2