Lineage for d5dw1d_ (5dw1 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993781Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1993941Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1993942Protein automated matches [190615] (10 species)
    not a true protein
  7. 1993960Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)
  8. 1994205Domain d5dw1d_: 5dw1 D: [318719]
    automated match to d2dwwa_
    complexed with 5gd, na

Details for d5dw1d_

PDB Entry: 5dw1 (more details), 1.55 Å

PDB Description: x-ray crystal structure of human brd2(bd2) in complex with rvx297 to 1.55 a resolution
PDB Compounds: (D:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d5dw1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dw1d_ a.29.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

SCOPe Domain Coordinates for d5dw1d_:

Click to download the PDB-style file with coordinates for d5dw1d_.
(The format of our PDB-style files is described here.)

Timeline for d5dw1d_: