![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) ![]() core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
![]() | Family a.238.1.1: BAR domain [103658] (4 proteins) sensor of membrane curvature |
![]() | Protein automated matches [190594] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187606] (5 PDB entries) |
![]() | Domain d5c5ba1: 5c5b A:5-273 [318711] Other proteins in same PDB: d5c5ba2, d5c5ba3, d5c5bb1, d5c5bb2, d5c5bc2, d5c5bc3, d5c5bd1, d5c5bd2 automated match to d2q13a1 complexed with gol |
PDB Entry: 5c5b (more details), 2.9 Å
SCOPe Domain Sequences for d5c5ba1:
Sequence, based on SEQRES records: (download)
>d5c5ba1 a.238.1.1 (A:5-273) automated matches {Human (Homo sapiens) [TaxId: 9606]} dklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltskl lkeyekqrfplggddevmsstlqqfskvidelsschavlstqladammfpitqfkerdlk eiltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfca lntlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsdi etmqqtiedlevasdplyvpdpdptkfpv
>d5c5ba1 a.238.1.1 (A:5-273) automated matches {Human (Homo sapiens) [TaxId: 9606]} dklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltskl lkeyekevmsstlqqfskvidelsschavlstqladammfpitqfkerdlkeiltlkevf qiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfcalntlqykkk iallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsdietmqqtied levasdplyvpdpdptkfpv
Timeline for d5c5ba1: