SCOPe 2.08: Domain d5c6eb_: 5c6e B:

Lineage for d5c6eb_ (5c6e B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries)

8. Domain d5c6eb_: 5c6e B: [318704]
   Other proteins in same PDB: d5c6ea_
   automated match to d1ns9b_
   complexed with cyn, dod, hem

Details for d5c6eb_

PDB Entry: 5c6e, 1.7 Å

PDB Description: joint x-ray/neutron structure of equine cyanomet hemoglobin in r state

PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d5c6eb_:

Sequence; same for both SEQRES and ATOM records:

>d5c6eb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

Timeline for d5c6eb_:

• d5c6eb_ first appeared in SCOPe 2.06
  
• d5c6eb_ appears in SCOPe 2.07