![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries) |
![]() | Domain d5c6eb_: 5c6e B: [318704] Other proteins in same PDB: d5c6ea_ automated match to d1ns9b_ complexed with cyn, dod, hem |
PDB Entry: 5c6e (more details), 1.7 Å
SCOPe Domain Sequences for d5c6eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c6eb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]} vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk dftpelqasyqkvvagvanalahkyh
Timeline for d5c6eb_: