Lineage for d5c55b_ (5c55 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2421872Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2421873Protein automated matches [190115] (77 species)
    not a true protein
  7. 2422049Species Corynebacterium glutamicum [TaxId:196627] [318685] (2 PDB entries)
  8. 2422059Domain d5c55b_: 5c55 B: [318691]
    automated match to d3lera_
    complexed with act, edo, gol, pyr; mutant

Details for d5c55b_

PDB Entry: 5c55 (more details), 1.7 Å

PDB Description: crystal structure of the y138f mutant of c.glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
PDB Compounds: (B:) Dihydrodipicolinate synthase/N-acetylneuraminate lyase

SCOPe Domain Sequences for d5c55b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c55b_ c.1.10.0 (B:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
tftgvippvmtplhadgsvdveslrklvdhlinggvdglfalgssgeaafltraqrklal
ttiiehtagrvpvtagvietttarvielvedaleagaeglvatapfytrthdveieehfr
kihaaapelplfafnipvsvhsnlnpvmlltlakdgvlagtkdssgndgairslieardd
aglteqfkiltgsettvdfaylagadgvvpglgnvdpaayaalaklcldgkwaeaaalqk
rinhlfhivfvgdtshmsgssaglggfktalahlgiiesnamavphqslsdeetarihai
vdefly

SCOPe Domain Coordinates for d5c55b_:

Click to download the PDB-style file with coordinates for d5c55b_.
(The format of our PDB-style files is described here.)

Timeline for d5c55b_: