Lineage for d5c2jb_ (5c2j B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2447883Protein CDC42 [52619] (2 species)
  7. 2447927Species Mouse (Mus musculus) [TaxId:10090] [159559] (2 PDB entries)
  8. 2447930Domain d5c2jb_: 5c2j B: [318684]
    automated match to d1ajea_
    complexed with af3, gdp, mg

Details for d5c2jb_

PDB Entry: 5c2j (more details), 2.5 Å

PDB Description: complex structure of the gap domain of mgcracgap and cdc42
PDB Compounds: (B:) Cell division control protein 42 homolog

SCOPe Domain Sequences for d5c2jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c2jb_ c.37.1.8 (B:) CDC42 {Mouse (Mus musculus) [TaxId: 10090]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrrcvll

SCOPe Domain Coordinates for d5c2jb_:

Click to download the PDB-style file with coordinates for d5c2jb_.
(The format of our PDB-style files is described here.)

Timeline for d5c2jb_: