![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
![]() | Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
![]() | Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
![]() | Protein automated matches [226856] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) |
![]() | Domain d5a4ba2: 5a4b A:149-257 [318681] automated match to d1tjta2 mutant |
PDB Entry: 5a4b (more details), 2.01 Å
SCOPe Domain Sequences for d5a4ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a4ba2 a.40.1.0 (A:149-257) automated matches {Human (Homo sapiens) [TaxId: 9606]} eetsakeglllwcqrktapyrnvniqnfhtswkdglglcalihrhrpdlidysklnkddp igninlameiaekhldipkmldaedivntpkpderaimtyvscfyhafa
Timeline for d5a4ba2: