Lineage for d1ki7a_ (1ki7 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 22944Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 protein domains)
  6. 23000Protein Thymidine kinase [52552] (1 species)
  7. 23001Species Herpes simplex virus type 1, different strains [TaxId:10298] [52553] (17 PDB entries)
  8. 23016Domain d1ki7a_: 1ki7 A: [31868]

Details for d1ki7a_

PDB Entry: 1ki7 (more details), 2.2 Å

PDB Description: crystal structure of thymidine kinase from herpes simplex virus type i complexed with 5-iododeoxyuridine

SCOP Domain Sequences for d1ki7a_:

Sequence, based on SEQRES records: (download)

>d1ki7a_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
gmvqthvttpgsipticdlartfaremge

Sequence, based on observed residues (ATOM records): (download)

>d1ki7a_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains}
mptllrvyidgphgmgkttttqllvdivyvpepmtywrvlgasetianiyttqhrldqge
isagdaavvmtsaqitmgmpyavtdavlaphiggeagssapppaltlifdrhpiaallcy
paarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldlaml
aairrvygllantvrylqcggswredwgqlprphigdtlftlfrapellapngdlynvfa
waldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdlartfa
remge

SCOP Domain Coordinates for d1ki7a_:

Click to download the PDB-style file with coordinates for d1ki7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ki7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ki7b_