Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (64 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries) |
Domain d4uhle1: 4uhl E:61-502 [318672] Other proteins in same PDB: d4uhla2, d4uhlb2, d4uhlc2, d4uhld2, d4uhle2, d4uhlf2, d4uhlg2, d4uhlh2 automated match to d3khma_ complexed with hem, vfv |
PDB Entry: 4uhl (more details), 2.5 Å
SCOPe Domain Sequences for d4uhle1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uhle1 a.104.1.0 (E:61-502) automated matches {Human (Homo sapiens) [TaxId: 9606]} ppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaallfns knedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiieketk eyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfshaawl lpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrpltdde vagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydqlkdl nlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswverld fnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidgyfp tvnyttmihtpenpvirykrrs
Timeline for d4uhle1: