SCOPe 2.08: Domain d4zttf1: 4ztt F:2-163

Lineage for d4zttf1 (4ztt F:2-163)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Escherichia coli [TaxId:536056] [318611] (1 PDB entry)

8. Domain d4zttf1: 4ztt F:2-163 [318661]
   Other proteins in same PDB: d4zttb2, d4ztte2, d4zttf2
   automated match to d4reua_
   complexed with fe, fe2, feo, gol, o, oh, oxy, per; mutant

Details for d4zttf1

PDB Entry: 4ztt, 1.83 Å

PDB Description: crystal structures of ferritin mutants reveal diferric-peroxo intermediates

PDB Compounds: (F:) Bacterial non-heme ferritin

SCOPe Domain Sequences for d4zttf1:

Sequence; same for both SEQRES and ATOM records:

>d4zttf1 a.25.1.1 (F:2-163) automated matches {Escherichia coli [TaxId: 536056]}
lkpemieklneqmnlelyasllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstldt

Timeline for d4zttf1:

• d4zttf1 first appeared in SCOPe 2.06
  
• d4zttf1 appears in SCOPe 2.07