Lineage for d2ki5b_ (2ki5 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109585Protein Thymidine kinase [52552] (4 species)
    contains insert all-alpha subdomain, res. 251-322
  7. 2109599Species Herpes simplex virus type 1, different strains [TaxId:10298] [52553] (33 PDB entries)
    Uniprot P03176 46-375
  8. 2109621Domain d2ki5b_: 2ki5 B: [31863]
    protein/DNA complex; complexed with ac2, so4

Details for d2ki5b_

PDB Entry: 2ki5 (more details), 1.9 Å

PDB Description: herpes simplex type-1 thymidine kinase in complex with the drug aciclovir at 1.9a resolution
PDB Compounds: (B:) protein (thymidine kinase)

SCOPe Domain Sequences for d2ki5b_:

Sequence, based on SEQRES records: (download)

>d2ki5b_ c.37.1.1 (B:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
gmvqthvttpgsipticdlartfaremgea

Sequence, based on observed residues (ATOM records): (download)

>d2ki5b_ c.37.1.1 (B:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}
mptllrvyidgphgmgkttttqllvalgdivyvpepmtywrvlgasetianiyttqhrld
qgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagppaltlifdrhpiaallcyp
aarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldlamla
airrvygllantvrylqcggswredwgqlsagprphigdtlftlfrapellapngdlynv
fawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdlart
faremgea

SCOPe Domain Coordinates for d2ki5b_:

Click to download the PDB-style file with coordinates for d2ki5b_.
(The format of our PDB-style files is described here.)

Timeline for d2ki5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ki5a_