Lineage for d4zttc_ (4ztt C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990371Protein automated matches [190041] (27 species)
    not a true protein
  7. 1990570Species Escherichia coli [TaxId:536056] [318611] (1 PDB entry)
  8. 1990573Domain d4zttc_: 4ztt C: [318628]
    Other proteins in same PDB: d4zttb2, d4ztte2, d4zttf2
    automated match to d4reua_
    complexed with fe, fe2, feo, gol, o, oh, oxy, per; mutant

Details for d4zttc_

PDB Entry: 4ztt (more details), 1.83 Å

PDB Description: crystal structures of ferritin mutants reveal diferric-peroxo intermediates
PDB Compounds: (C:) Bacterial non-heme ferritin

SCOPe Domain Sequences for d4zttc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zttc_ a.25.1.1 (C:) automated matches {Escherichia coli [TaxId: 536056]}
lkpemieklneqmnlelyasllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstldt

SCOPe Domain Coordinates for d4zttc_:

Click to download the PDB-style file with coordinates for d4zttc_.
(The format of our PDB-style files is described here.)

Timeline for d4zttc_: