Lineage for d5jrob1 (5jro B:1-201)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2464786Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 2464991Protein automated matches [190235] (2 species)
    not a true protein
  7. 2465033Species Yersinia pestis [TaxId:214092] [195328] (2 PDB entries)
  8. 2465036Domain d5jrob1: 5jro B:1-201 [318624]
    Other proteins in same PDB: d5jroa2, d5jrob2
    automated match to d1t5ba_
    complexed with gol

Details for d5jrob1

PDB Entry: 5jro (more details), 2.54 Å

PDB Description: the crystal structure of azoreductase from yersinia pestis co92 in its apo form
PDB Compounds: (B:) FMN-dependent NADH-azoreductase

SCOPe Domain Sequences for d5jrob1:

Sequence, based on SEQRES records: (download)

>d5jrob1 c.23.5.3 (B:1-201) automated matches {Yersinia pestis [TaxId: 214092]}
mskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgalr
psgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfr
ytekgpeglvtgkraiiltsrggihkdtptdlvvpylrlflgfigitdvefvfaegiayg
pevatkaqadaktllaqvvaa

Sequence, based on observed residues (ATOM records): (download)

>d5jrob1 c.23.5.3 (B:1-201) automated matches {Yersinia pestis [TaxId: 214092]}
mskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgalr
psaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfryt
ekgpeglvtgkraiiltsrgtptdlvvpylrlflgfigitdvefvfaeadaktllaqvva
a

SCOPe Domain Coordinates for d5jrob1:

Click to download the PDB-style file with coordinates for d5jrob1.
(The format of our PDB-style files is described here.)

Timeline for d5jrob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jrob2