![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.3: Quinone reductase [52235] (4 proteins) binds FAD |
![]() | Protein automated matches [190235] (2 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [195328] (2 PDB entries) |
![]() | Domain d5jrob1: 5jro B:1-201 [318624] Other proteins in same PDB: d5jroa2, d5jrob2 automated match to d1t5ba_ complexed with gol |
PDB Entry: 5jro (more details), 2.54 Å
SCOPe Domain Sequences for d5jrob1:
Sequence, based on SEQRES records: (download)
>d5jrob1 c.23.5.3 (B:1-201) automated matches {Yersinia pestis [TaxId: 214092]} mskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgalr psgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfr ytekgpeglvtgkraiiltsrggihkdtptdlvvpylrlflgfigitdvefvfaegiayg pevatkaqadaktllaqvvaa
>d5jrob1 c.23.5.3 (B:1-201) automated matches {Yersinia pestis [TaxId: 214092]} mskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgalr psaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfryt ekgpeglvtgkraiiltsrgtptdlvvpylrlflgfigitdvefvfaeadaktllaqvva a
Timeline for d5jrob1: