Lineage for d5jmyb_ (5jmy B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570449Family d.92.1.4: Neutral endopeptidase (neprilysin) [55502] (2 proteins)
  6. 2570450Protein Neutral endopeptidase (neprilysin) [55503] (1 species)
    contains thermolysin-like catalytic domain (residues 419-749)
    the N-terminal half of the structure is multihelical
  7. 2570451Species Human (Homo sapiens) [TaxId:9606] [55504] (9 PDB entries)
    Uniprot P08473 54-749
  8. 2570459Domain d5jmyb_: 5jmy B: [318623]
    automated match to d4ctha_
    complexed with 6ld, nag, zn

Details for d5jmyb_

PDB Entry: 5jmy (more details), 2 Å

PDB Description: neprilysin complexed with lbq657
PDB Compounds: (B:) Neprilysin

SCOPe Domain Sequences for d5jmyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jmyb_ d.92.1.4 (B:) Neutral endopeptidase (neprilysin) {Human (Homo sapiens) [TaxId: 9606]}
gickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdel
evvlkdvlqepktedivavqkakalyrscinesaidsrggepllkllpdiygwpvatenw
eqkygaswtaekaiaqlnskygkkvlinlfvgtddknsvnhvihidqprlglpsrdyyec
tgiykeactayvdfmisvarlirqeerlpidenqlalemnkvmelekeianatakpedrn
dpmllynkmtlaqiqnnfsleingkpfswlnftneimstvnisitneedvvvyapeyltk
lkpiltkysardlqnlmswrfimdlvsslsrtykesrnafrkalygttsetatwrrcany
vngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltwmdaetkkraeekal
aikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkde
wisgaavvnafyssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddng
rnfnkdgdlvdwwtqqsasnfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngg
lgqayrayqnyikkngeekllpgldlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhsp
gnfriigtlqnsaefseafhcrknsymnpekkcrvw

SCOPe Domain Coordinates for d5jmyb_:

Click to download the PDB-style file with coordinates for d5jmyb_.
(The format of our PDB-style files is described here.)

Timeline for d5jmyb_: